Lineage for d3fe1c1 (3fe1 C:6-190)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2492670Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2492671Protein automated matches [226839] (63 species)
    not a true protein
  7. 2492889Species Human (Homo sapiens) [TaxId:9606] [224896] (68 PDB entries)
  8. 2492938Domain d3fe1c1: 3fe1 C:6-190 [209874]
    Other proteins in same PDB: d3fe1a3, d3fe1b3
    automated match to d2qw9a1
    complexed with adp, cl, mg, pge, po4

Details for d3fe1c1

PDB Entry: 3fe1 (more details), 2.2 Å

PDB Description: Crystal structure of the human 70kDa heat shock protein 6 (Hsp70B') ATPase domain in complex with ADP and inorganic phosphate
PDB Compounds: (C:) Heat shock 70 kDa protein 6

SCOPe Domain Sequences for d3fe1c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fe1c1 c.55.1.0 (C:6-190) automated matches {Human (Homo sapiens) [TaxId: 9606]}
elavgidlgttyscvgvfqqgrveilandqgnrttpsyvaftdterlvgdaaksqaalnp
hntvfdakrligrkfadttvqsdmkhwpfrvvseggkpkvrvcyrgedktfypeeissmv
lskmketaeaylgqpvkhavitvpayfndsqrqatkdagaiaglnvlriineptaaaiay
gldrr

SCOPe Domain Coordinates for d3fe1c1:

Click to download the PDB-style file with coordinates for d3fe1c1.
(The format of our PDB-style files is described here.)

Timeline for d3fe1c1: