Lineage for d1pmd_2 (1pmd 693-750)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.11: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54183] (1 superfamily) Superfamily d.11.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54184] (1 family) 
Family d.11.1.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54185] (1 protein) Protein Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54186] (1 species) Species Streptococcus pneumoniae [TaxId:1313] [54187] (3 PDB entries) 
Domain d1pmd_2: 1pmd 693-750 [37492]
Other proteins in same PDB: d1pmd_3, d1pmd_4
Details for d1pmd_2
PDB Entry: 1pmd (more details), 3.5 Å
PDB Description: penicillin-binding protein 2x (pbp-2x)
SCOP Domain Sequences for d1pmd_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pmd_2 d.11.1.1 (693-750) Penicillin-binding protein 2x (pbp-2x), c-terminal domain {Streptococcus pneumoniae}
aeevpdmygwtketaetlakwlnielefqgsgstvqkqdvrantaikdikkitltlgd
SCOP Domain Coordinates for d1pmd_2:
Click to download the PDB-style file with coordinates for d1pmd_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pmd_2:
- d1pmd_2 first appeared (with stable ids) in SCOP 1.55
- d1pmd_2 appears in SCOP 1.59
- d1pmd_2 appears in the current release, SCOPe 2.08, called d1pmda2
View in 3D
