Lineage for d6e5bt_ (6e5b T:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2995063Species Human (Homo sapiens) [TaxId:9606] [311423] (25 PDB entries)
  8. 2995151Domain d6e5bt_: 6e5b T: [373917]
    Other proteins in same PDB: d6e5ba_, d6e5bb_, d6e5bc_, d6e5bd_, d6e5be_, d6e5bg_, d6e5bh_, d6e5bi_, d6e5bj_, d6e5bk_, d6e5bm_, d6e5bn_, d6e5bo_, d6e5bp_, d6e5bq_, d6e5br_, d6e5bs_, d6e5bu_, d6e5bv_, d6e5bw_, d6e5bx_, d6e5by_
    automated match to d1irug_
    complexed with huj, na, scn

Details for d6e5bt_

PDB Entry: 6e5b (more details), 2.77 Å

PDB Description: human immunoproteasome 20s particle in complex with compound 1
PDB Compounds: (T:) Proteasome subunit alpha type-3

SCOPe Domain Sequences for d6e5bt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6e5bt_ d.153.1.4 (T:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gtgydlsastfspdgrvfqveyamkavensstaigirckdgvvfgveklvlsklyeegsn
krlfnvdrhvgmavaglladarsladiareeasnfrsnfgyniplkhladrvamyvhayt
lysavrpfgcsfmlgsysvndgaqlymidpsgvsygywgcaigkarqaakteieklqmke
mtcrdivkevakiiyivhdevkdkafelelswvgeltngrheivpkdireeaekyakesl
k

SCOPe Domain Coordinates for d6e5bt_:

Click to download the PDB-style file with coordinates for d6e5bt_.
(The format of our PDB-style files is described here.)

Timeline for d6e5bt_: