SCOPe 2.08: Domain d6rgqw_: 6rgq W:

Lineage for d6rgqw_ (6rgq W:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [311423] (25 PDB entries)

8. Domain d6rgqw_: 6rgq W: [373821]
   Other proteins in same PDB: d6rgqa_, d6rgqb_, d6rgqc_, d6rgqd_, d6rgqe_, d6rgqf_, d6rgqg_, d6rgqh_, d6rgqj_, d6rgqk_, d6rgql_, d6rgqm_, d6rgqn_, d6rgqo_, d6rgqp_, d6rgqq_, d6rgqr_, d6rgqs_, d6rgqt_, d6rgqu_, d6rgqv_, d6rgqx_, d6rgqy_, d6rgqz_
   automated match to d5le5h_

Details for d6rgqw_

PDB Entry: 6rgq, 2.6 Å

PDB Description: human 20s proteasome

PDB Compounds: (W:) Proteasome subunit beta type-7

SCOPe Domain Sequences for d6rgqw_:

Sequence; same for both SEQRES and ATOM records:

>d6rgqw_ d.153.1.4 (W:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ttiagvvykdgivlgadtrategmvvadkncskihfispniyccgagtaadtdmttqlis
snlelhslstgrlprvvtanrmlkqmlfryqgyigaalvlggvdvtgphlysiyphgstd
klpyvtmgsgslaamavfedkfrpdmeeeeaknlvseaiaagifndlgsgsnidlcvisk
nkldflrpytvpnkkgtrlgryrcekgttavltekitple

Timeline for d6rgqw_:

• d6rgqw_ first appeared in SCOPe 2.07