SCOPe 2.05: Domain d1krba_: 1krb A:

Lineage for d1krba_ (1krb A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
   alpha(3)-beta(2); antiparallel hairpin

4. Superfamily d.8.1: Urease, gamma-subunit [54111] (2 families)

5. Family d.8.1.1: Urease, gamma-subunit [54112] (2 proteins)
   automatically mapped to Pfam PF00547

6. Protein Urease, gamma-subunit [54113] (4 species)

7. Species Klebsiella aerogenes [TaxId:28451] [54114] (27 PDB entries)

8. Domain d1krba_: 1krb A: [37349]
   Other proteins in same PDB: d1krbb_, d1krbc1, d1krbc2
   complexed with ni; mutant

Details for d1krba_

PDB Entry: 1krb, 2.5 Å

PDB Description: crystal structure of klebsiella aerogenes urease, its apoenzyme and two active site mutants

PDB Compounds: (A:) urease

SCOPe Domain Sequences for d1krba_:

Sequence; same for both SEQRES and ATOM records:

>d1krba_ d.8.1.1 (A:) Urease, gamma-subunit {Klebsiella aerogenes [TaxId: 28451]}
meltprekdklllftaalvaerrlarglklnypesvalisafimegardgksvaslmeeg
rhvltreqvmegvpemipdiqveatfpdgsklvtvhnpii

Timeline for d1krba_:

• d1krba_ first appeared (with stable ids) in SCOP 1.55
  
• d1krba_ appears in SCOPe 2.04
  
• d1krba_ appears in SCOPe 2.06
  
• d1krba_ appears in the current release, SCOPe 2.08