SCOPe 2.05: Domain d1krbb_: 1krb B:

Lineage for d1krbb_ (1krb B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.3: Urease, beta-subunit [51278] (1 family)

5. Family b.85.3.1: Urease, beta-subunit [51279] (2 proteins)

6. Protein Urease, beta-subunit [51280] (4 species)

7. Species Klebsiella aerogenes [TaxId:28451] [51281] (27 PDB entries)

8. Domain d1krbb_: 1krb B: [28342]
   Other proteins in same PDB: d1krba_, d1krbc1, d1krbc2
   complexed with ni; mutant

Details for d1krbb_

PDB Entry: 1krb, 2.5 Å

PDB Description: crystal structure of klebsiella aerogenes urease, its apoenzyme and two active site mutants

PDB Compounds: (B:) urease

SCOPe Domain Sequences for d1krbb_:

Sequence; same for both SEQRES and ATOM records:

>d1krbb_ b.85.3.1 (B:) Urease, beta-subunit {Klebsiella aerogenes [TaxId: 28451]}
mipgeyhvkpgqialntgratcrvvvenhgdrpiqvgshyhfaevnpalkfdrqqaagyr
lnipagtavrfepgqkrevelvafaghravfgfrgevmgpl

Timeline for d1krbb_:

• d1krbb_ first appeared (with stable ids) in SCOP 1.55
  
• d1krbb_ appears in SCOPe 2.04
  
• d1krbb_ appears in SCOPe 2.06
  
• d1krbb_ appears in the current release, SCOPe 2.08