Lineage for d6h5oa1 (6h5o A:27-138)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936287Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2937177Family d.17.4.0: automated matches [191337] (1 protein)
    not a true family
  6. 2937178Protein automated matches [190205] (35 species)
    not a true protein
  7. 2937309Species Staphylococcus aureus [TaxId:158878] [256155] (6 PDB entries)
  8. 2937320Domain d6h5oa1: 6h5o A:27-138 [372861]
    Other proteins in same PDB: d6h5oa2, d6h5oa3, d6h5ob2, d6h5ob3
    automated match to d1vqqa1
    complexed with cd, jpp

Details for d6h5oa1

PDB Entry: 6h5o (more details), 2.82 Å

PDB Description: crystal structure of pbp2a from mrsa in complex with piperacillin at active site.
PDB Compounds: (A:) penicillin binding protein 2 prime

SCOPe Domain Sequences for d6h5oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h5oa1 d.17.4.0 (A:27-138) automated matches {Staphylococcus aureus [TaxId: 158878]}
dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik
kvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqk

SCOPe Domain Coordinates for d6h5oa1:

Click to download the PDB-style file with coordinates for d6h5oa1.
(The format of our PDB-style files is described here.)

Timeline for d6h5oa1: