Lineage for d6mlva_ (6mlv A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2914343Protein Lysine-,arginine-,ornithine-binding (LAO) protein [53856] (5 species)
  7. 2914346Species Salmonella enterica [TaxId:99287] [372546] (1 PDB entry)
  8. 2914347Domain d6mlva_: 6mlv A: [372547]
    automated match to d1lsta_
    mutant

Details for d6mlva_

PDB Entry: 6mlv (more details), 2.08 Å

PDB Description: crystal structure of the periplasmic lysine-, arginine-, ornithine- binding protein (lao) y14a mutant from salmonella typhimurium
PDB Compounds: (A:) Lysine/arginine/ornithine-binding periplasmic protein

SCOPe Domain Sequences for d6mlva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mlva_ c.94.1.1 (A:) Lysine-,arginine-,ornithine-binding (LAO) protein {Salmonella enterica [TaxId: 99287]}
alpqtvrigtdttaapfsskdakgefigfdidlgnemckrmqvkctwvasdfdalipslk
akkidaiisslsitdkrqqeiafsdklyaadsrliaakgspiqptleslkgkhvgvlqgs
tqeayandnwrtkgvdvvayanqdliysdltagrldaalqdevaasegflkqpagkeyaf
agpsvkdkkyfgdgtgvglrkddtelkaafdkaltelrqdgtydkmakkyfdfnvygd

SCOPe Domain Coordinates for d6mlva_:

Click to download the PDB-style file with coordinates for d6mlva_.
(The format of our PDB-style files is described here.)

Timeline for d6mlva_: