Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein c-src tyrosine kinase [56155] (3 species) PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase |
Species Human (Homo sapiens) [TaxId:9606] [56156] (14 PDB entries) |
Domain d6e6eb_: 6e6e B: [372297] automated match to d4mxob_ complexed with hvy |
PDB Entry: 6e6e (more details), 2.15 Å
SCOPe Domain Sequences for d6e6eb_:
Sequence, based on SEQRES records: (download)
>d6e6eb_ d.144.1.7 (B:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} daweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkkl rheklvqlyavvseepiyivteymskgslldflkgetgkylrlpqlvdmaaqiasgmayv ermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikwtapeaalyg rftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcq cwrkepeerptfeylqafledyftstepqyqpgenl
>d6e6eb_ d.144.1.7 (B:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} daweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkkl rheklvqlyavvseepiyivteymskgslldflkgetgkylrlpqlvdmaaqiasgmayv ermnyvhrdlraanilvgenlvckvadfglarliakfpikwtapeaalygrftiksdvws fgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkepeerp tfeylqafledyftstepqyqpgenl
Timeline for d6e6eb_: