SCOPe 2.08: Domain d6po4c1: 6po4 C:1-231

Lineage for d6po4c1 (6po4 C:1-231)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)

6. Protein automated matches [190142] (21 species)
   not a true protein

7. Species Haemophilus influenzae [TaxId:374933] [371244] (1 PDB entry)

8. Domain d6po4c1: 6po4 C:1-231 [371245]
   Other proteins in same PDB: d6po4a2, d6po4b2, d6po4c2, d6po4d2, d6po4e2, d6po4f2
   automated match to d4f1wa_
   complexed with ade, bo3, hcs

Details for d6po4c1

PDB Entry: 6po4, 2.1 Å

PDB Description: 2.1 angstrom resolution crystal structure of 5'-methylthioadenosine/s- adenosylhomocysteine nucleosidase (mtnn) from haemophilus influenzae pittii.

PDB Compounds: (C:) 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

SCOPe Domain Sequences for d6po4c1:

Sequence; same for both SEQRES and ATOM records:

>d6po4c1 c.56.2.1 (C:1-231) automated matches {Haemophilus influenzae [TaxId: 374933]}
mkigivgamaqeveilknlmtertetrvasavifegkingkdiallqsgigkvaaaigtt
allqlakpdcvintgsaggvakglkvgdivisdetryhdadvtafgyekgqlpanpaafl
sdkkladlaqemaekqgqsvkrglicsgdsfinsedkiaqiqadfpnvmgvemeataiaq
vcyafnvpfvvvraisdggdgkasisfeeflplaakqssalvlemidrlss

Timeline for d6po4c1:

• d6po4c1 first appeared in SCOPe 2.07