Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) |
Superfamily d.3.1: Cysteine proteinases [54001] (7 families) |
Family d.3.1.5: Arylamine N-acetyltransferase [54047] (1 protein) |
Protein Arylamine N-acetyltransferase [54048] (1 species) |
Species Salmonella typhimurium [TaxId:90371] [54049] (1 PDB entry) |
Domain d1e2tb_: 1e2t B: [37122] |
PDB Entry: 1e2t (more details), 2.8 Å
SCOP Domain Sequences for d1e2tb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e2tb_ d.3.1.5 (B:) Arylamine N-acetyltransferase {Salmonella typhimurium} hmtsflhayftrlhcqplgvptvealrtlhlahncaipfenldvllpreiqldetaleek llyarrggycfelnglferalrdigfnvrsllgrvilshpaslpprthrlllvdvedeqw iadvgfggqtltaplrlqaeiaqqtphgeyrlmqegstwilqfrhhehwqsmycfdlgvq qqsdhvmgnfwsahwpqshfrhhllmcrhlpdggkltltnfhftryhqghaveqvnvpdv pslyqllqqqfglgvndvkhgfteaelaavmaaf
Timeline for d1e2tb_: