Lineage for d1qrka4 (1qrk A:191-511)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1014844Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1014845Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1015240Family d.3.1.4: Transglutaminase core [54044] (3 proteins)
  6. 1015246Protein Transglutaminase catalytic domain [54045] (4 species)
  7. 1015247Species Human (Homo sapiens), blood isozyme [TaxId:9606] [54046] (8 PDB entries)
    Coagulation factor XIII
  8. 1015256Domain d1qrka4: 1qrk A:191-511 [37119]
    Other proteins in same PDB: d1qrka1, d1qrka2, d1qrka3, d1qrkb1, d1qrkb2, d1qrkb3
    complexed with sr

Details for d1qrka4

PDB Entry: 1qrk (more details), 2.5 Å

PDB Description: human factor xiii with strontium bound in the ion site
PDB Compounds: (A:) protein (coagulation factor xiii)

SCOPe Domain Sequences for d1qrka4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qrka4 d.3.1.4 (A:191-511) Transglutaminase catalytic domain {Human (Homo sapiens), blood isozyme [TaxId: 9606]}
davyldnekereeyvlndigvifygevndiktrswsygqfedgildtclyvmdraqmdls
grgnpikvsrvgsamvnakddegvlvgswdniyaygvppsawtgsvdilleyrssenpvr
ygqcwvfagvfntflrclgiparivtnyfsahdndanlqmdifleedgnvnskltkdsvw
nyhcwneawmtrpdlpvgfggwqavdstpqensdgmyrcgpasvqaikhghvcfqfdapf
vfaevnsdliyitakkdgthvvenvdathigklivtkqiggdgmmditdtykfqegqeee
rlaletalmygakkplntegv

SCOPe Domain Coordinates for d1qrka4:

Click to download the PDB-style file with coordinates for d1qrka4.
(The format of our PDB-style files is described here.)

Timeline for d1qrka4: