Lineage for d1qrka3 (1qrk A:628-727)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 936565Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (1 family) (S)
  5. 936566Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein)
  6. 936567Protein Transglutaminase, two C-terminal domains [49311] (4 species)
    duplication
  7. 936568Species Human (Homo sapiens), blood isozyme [TaxId:9606] [49312] (8 PDB entries)
    Coagulation factor XIII,
  8. 936586Domain d1qrka3: 1qrk A:628-727 [22188]
    Other proteins in same PDB: d1qrka1, d1qrka4, d1qrkb1, d1qrkb4
    complexed with sr

Details for d1qrka3

PDB Entry: 1qrk (more details), 2.5 Å

PDB Description: human factor xiii with strontium bound in the ion site
PDB Compounds: (A:) protein (coagulation factor xiii)

SCOPe Domain Sequences for d1qrka3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qrka3 b.1.5.1 (A:628-727) Transglutaminase, two C-terminal domains {Human (Homo sapiens), blood isozyme [TaxId: 9606]}
tipeiiikvrgtqvvgsdmtvtveftnplketlrnvwvhldgpgvtrpmkkmfreirpns
tvqweevcrpwvsghrkliasmssdslrhvygeldvqiqr

SCOPe Domain Coordinates for d1qrka3:

Click to download the PDB-style file with coordinates for d1qrka3.
(The format of our PDB-style files is described here.)

Timeline for d1qrka3: