Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) |
Family d.109.1.1: Gelsolin-like [55754] (5 proteins) |
Protein automated matches [226883] (2 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [256589] (13 PDB entries) |
Domain d6i4gh_: 6i4g H: [370206] Other proteins in same PDB: d6i4ga1, d6i4ga2, d6i4gb1, d6i4gb2 automated match to d4cbug_ complexed with atp, bme, ca, k, mg, scn |
PDB Entry: 6i4g (more details), 2 Å
SCOPe Domain Sequences for d6i4gh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6i4gh_ d.109.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} vvehpeflkagkepglqiwrvekfdlvpvppnlygdfftgdayvilktvqlrngnlqydl hywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesstfsgyfksglkykkggv asgf
Timeline for d6i4gh_: