Lineage for d6i4gg_ (6i4g G:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2576227Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2576228Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2576229Family d.109.1.1: Gelsolin-like [55754] (5 proteins)
  6. 2576413Protein automated matches [226883] (2 species)
    not a true protein
  7. 2576420Species Mouse (Mus musculus) [TaxId:10090] [256589] (13 PDB entries)
  8. 2576432Domain d6i4gg_: 6i4g G: [370167]
    Other proteins in same PDB: d6i4ga1, d6i4ga2, d6i4gb1, d6i4gb2
    automated match to d4cbug_
    complexed with atp, bme, ca, k, mg, scn

Details for d6i4gg_

PDB Entry: 6i4g (more details), 2 Å

PDB Description: crystal structure of plasmodium falciparum actin i (h74q) in the mg-k- atp state
PDB Compounds: (G:) gelsolin

SCOPe Domain Sequences for d6i4gg_:

Sequence, based on SEQRES records: (download)

>d6i4gg_ d.109.1.1 (G:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vvehpeflkagkepglqiwrvekfdlvpvppnlygdfftgdayvilktvqlrngnlqydl
hywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesstfsgyfksglkykkggv
asgf

Sequence, based on observed residues (ATOM records): (download)

>d6i4gg_ d.109.1.1 (G:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vvehpeflkagkepglqiwrvekfdlvpvppnlygdfftgdayvilktvqgnlqydlhyw
lgnecsqdesgaaaiftvqlddylngravqhrevqgfesstfsgyfksglkykkggvasg
f

SCOPe Domain Coordinates for d6i4gg_:

Click to download the PDB-style file with coordinates for d6i4gg_.
(The format of our PDB-style files is described here.)

Timeline for d6i4gg_: