| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
| Protein automated matches [226905] (13 species) not a true protein |
| Species Plasmodium falciparum [TaxId:36329] [336601] (11 PDB entries) |
| Domain d6i4gb2: 6i4g B:148-373 [370179] Other proteins in same PDB: d6i4ga1, d6i4gb1, d6i4gg_, d6i4gh_ automated match to d3ub5a2 complexed with atp, bme, ca, k, mg, scn |
PDB Entry: 6i4g (more details), 2 Å
SCOPe Domain Sequences for d6i4gb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6i4gb2 c.55.1.1 (B:148-373) automated matches {Plasmodium falciparum [TaxId: 36329]}
rttgivldsgdgvshtvpiyegyalphaimrldlagrdlteylmkilhergygfstsaek
eivrdikeklcyialnfdeemktseqssdieksyelpdgniitvgnerfrcpealfqpsf
lgkeaagihtttfnsikkcdvdirkdlygnivlsggttmyegigerltrdittlapstmk
ikvvapperkysvwiggsilsslstfqqmwitkeeydesgpsivhr
Timeline for d6i4gb2:
View in 3DDomains from other chains: (mouse over for more information) d6i4ga1, d6i4ga2, d6i4gg_, d6i4gh_ |