Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (131 species) not a true protein |
Species Striga hermonthica [TaxId:68872] [278337] (16 PDB entries) |
Domain d6a9da1: 6a9d A:1-268 [369539] Other proteins in same PDB: d6a9da2 automated match to d5cbka_ complexed with gol |
PDB Entry: 6a9d (more details), 2.3 Å
SCOPe Domain Sequences for d6a9da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6a9da1 c.69.1.0 (A:1-268) automated matches {Striga hermonthica [TaxId: 68872]} mssiglahnvtilgsgettvvlghgygtdqsvwkllvpylvddykvllydhmgagttnpd yfdfdrysslegysydliaileefqvskciyvghsmssmaaavasifrpdlfhklvmisp tprlinteeyyggfeqkvmdetlrsldenfkslslgtaplllacdlesaamqeycrtlfn mrpdiaccitrmicgldlrpylghvtvpchiiqssndimvpvavgeylrknlggpsvvev mpteghlphlsmpevtipvvlrhirqdi
Timeline for d6a9da1: