SCOPe 2.08: Domain d6a9da1: 6a9d A:1-268

Lineage for d6a9da1 (6a9d A:1-268)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (131 species)
   not a true protein

7. Species Striga hermonthica [TaxId:68872] [278337] (16 PDB entries)

8. Domain d6a9da1: 6a9d A:1-268 [369539]
   Other proteins in same PDB: d6a9da2
   automated match to d5cbka_
   complexed with gol

Details for d6a9da1

PDB Entry: 6a9d, 2.3 Å

PDB Description: crystal structure of the strigolactone receptor shhtl7 from striga hermonthica

PDB Compounds: (A:) Hyposensitive to light 7

SCOPe Domain Sequences for d6a9da1:

Sequence; same for both SEQRES and ATOM records:

>d6a9da1 c.69.1.0 (A:1-268) automated matches {Striga hermonthica [TaxId: 68872]}
mssiglahnvtilgsgettvvlghgygtdqsvwkllvpylvddykvllydhmgagttnpd
yfdfdrysslegysydliaileefqvskciyvghsmssmaaavasifrpdlfhklvmisp
tprlinteeyyggfeqkvmdetlrsldenfkslslgtaplllacdlesaamqeycrtlfn
mrpdiaccitrmicgldlrpylghvtvpchiiqssndimvpvavgeylrknlggpsvvev
mpteghlphlsmpevtipvvlrhirqdi

Timeline for d6a9da1:

• d6a9da1 first appeared in SCOPe 2.07