Class a: All alpha proteins [46456] (289 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) contains one classic and one pseudo HhH motifs |
Family a.60.6.0: automated matches [254214] (1 protein) not a true family |
Protein automated matches [254482] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255046] (17 PDB entries) |
Domain d6ak6a1: 6ak6 A:137-230 [369250] Other proteins in same PDB: d6ak6a2, d6ak6a3 automated match to d4lzda1 protein/DNA complex; complexed with ctp, mn, so4 |
PDB Entry: 6ak6 (more details), 1.75 Å
SCOPe Domain Sequences for d6ak6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ak6a1 a.60.6.0 (A:137-230) automated matches {Human (Homo sapiens) [TaxId: 9606]} wmpayacqrptplthhntglsealeilaeaagfegsegrlltfcraasvlkalpspvttl sqlqglphfgehssrvvqellehgvceevervrr
Timeline for d6ak6a1: