Lineage for d5zo0a_ (5zo0 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780055Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 2780100Protein Xylanase II [49979] (21 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 2780174Species Hypocrea jecorina [TaxId:1344414] [365691] (11 PDB entries)
  8. 2780185Domain d5zo0a_: 5zo0 A: [368992]
    automated match to d4xqdb_
    complexed with dod

Details for d5zo0a_

PDB Entry: 5zo0 (more details), 1.65 Å

PDB Description: neutron structure of xylanase at pd5.4
PDB Compounds: (A:) Endo-1,4-beta-xylanase 2

SCOPe Domain Sequences for d5zo0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zo0a_ b.29.1.11 (A:) Xylanase II {Hypocrea jecorina [TaxId: 1344414]}
tiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvin
fsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrtq
rvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyfs
sgsasitvs

SCOPe Domain Coordinates for d5zo0a_:

Click to download the PDB-style file with coordinates for d5zo0a_.
(The format of our PDB-style files is described here.)

Timeline for d5zo0a_: