Lineage for d2wtth_ (2wtt H:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328122Fold a.53: p53 tetramerization domain [47718] (1 superfamily)
    core: 4 helices; bundle
  4. 2328123Superfamily a.53.1: p53 tetramerization domain [47719] (2 families) (S)
    homotetramer
  5. 2328184Family a.53.1.0: automated matches [259188] (1 protein)
    not a true family
  6. 2328185Protein automated matches [259190] (2 species)
    not a true protein
  7. 2328186Species Human (Homo sapiens) [TaxId:9606] [311354] (9 PDB entries)
  8. 2328216Domain d2wtth_: 2wtt H: [368790]
    automated match to d5hobg_

Details for d2wtth_

PDB Entry: 2wtt (more details), 2.3 Å

PDB Description: structure of the human p73 tetramerization domain (crystal form ii)
PDB Compounds: (H:) Tumor protein p73

SCOPe Domain Sequences for d2wtth_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wtth_ a.53.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tyylqvrgrenfeilmklkeslelmelvpqplvdsyrqqqqllqr

SCOPe Domain Coordinates for d2wtth_:

Click to download the PDB-style file with coordinates for d2wtth_.
(The format of our PDB-style files is described here.)

Timeline for d2wtth_: