Class a: All alpha proteins [46456] (289 folds) |
Fold a.53: p53 tetramerization domain [47718] (1 superfamily) core: 4 helices; bundle |
Superfamily a.53.1: p53 tetramerization domain [47719] (2 families) homotetramer |
Family a.53.1.0: automated matches [259188] (1 protein) not a true family |
Protein automated matches [259190] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [311354] (9 PDB entries) |
Domain d2wttg_: 2wtt G: [368788] automated match to d5hobg_ |
PDB Entry: 2wtt (more details), 2.3 Å
SCOPe Domain Sequences for d2wttg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wttg_ a.53.1.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]} dtyylqvrgrenfeilmklkeslelmelvpqplvdsyrqqqql
Timeline for d2wttg_: