PDB entry 2wtt

View 2wtt on RCSB PDB site
Description: structure of the human p73 tetramerization domain (crystal form II)
Class: transcription
Keywords: alternative splicing, oligomerization domain, cell-cycle control, transcription factor, cooperativity, phosphoprotein, ubl conjugation, activator, tumor suppression, development, transcription, apoptosis, cell cycle, DNA binding, transcription regulation
Deposited on 2009-09-21, released 2009-10-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-11-03, with a file datestamp of 2009-10-30.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.2333
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Tumor protein p73
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 2WTT
  • Uniprot O15350
  Domains in SCOPe 2.07: d2wtta_
• Chain 'B':
  Compound: Tumor protein p73
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 2WTT
  • Uniprot O15350
  Domains in SCOPe 2.07: d2wttb_
• Chain 'C':
  Compound: Tumor protein p73
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 2WTT
  • Uniprot O15350
  Domains in SCOPe 2.07: d2wttc_
• Chain 'D':
  Compound: Tumor protein p73
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 2WTT
  • Uniprot O15350 (Start-50)
  Domains in SCOPe 2.07: d2wttd_
• Chain 'E':
  Compound: Tumor protein p73
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 2WTT
  • Uniprot O15350
  Domains in SCOPe 2.07: d2wtte_
• Chain 'F':
  Compound: Tumor protein p73
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 2WTT
  • Uniprot O15350
  Domains in SCOPe 2.07: d2wttf_
• Chain 'G':
  Compound: Tumor protein p73
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 2WTT
  • Uniprot O15350
• Chain 'H':
  Compound: Tumor protein p73
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 2WTT
  • Uniprot O15350
• Chain 'I':
  Compound: Tumor protein p73
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 2WTT
  • Uniprot O15350
• Chain 'J':
  Compound: Tumor protein p73
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 2WTT
  • Uniprot O15350
• Chain 'K':
  Compound: Tumor protein p73
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 2WTT
  • Uniprot O15350
• Chain 'L':
  Compound: Tumor protein p73
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 2WTT
  • Uniprot O15350
• Chain 'M':
  Compound: Tumor protein p73
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 2WTT
  • Uniprot O15350
• Chain 'N':
  Compound: Tumor protein p73
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 2WTT
  • Uniprot O15350
  Domains in SCOPe 2.07: d2wttn_
• Chain 'O':
  Compound: Tumor protein p73
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 2WTT
  • Uniprot O15350
• Chain 'P':
  Compound: Tumor protein p73
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 2WTT
  • Uniprot O15350
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2wttA (A:)
  gsdedtyylqvrgrenfeilmklkeslelmelvpqplvdsyrqqqqllqrp
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2wttA (A:)
  edtyylqvrgrenfeilmklkeslelmelvpqplvdsyrqqq
  

  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >2wttB (B:)
  gsdedtyylqvrgrenfeilmklkeslelmelvpqplvdsyrqqqqllqrp
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2wttB (B:)
  edtyylqvrgrenfeilmklkeslelmelvpqplvdsyrqqqq
  

  
  
• Chain 'C':
  Sequence, based on SEQRES records: (download)
  

  >2wttC (C:)
  gsdedtyylqvrgrenfeilmklkeslelmelvpqplvdsyrqqqqllqrp
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2wttC (C:)
  dtyylqvrgrenfeilmklkeslelmelvpqplvdsyrqqqq
  

  
  
• Chain 'D':
  Sequence, based on SEQRES records: (download)
  

  >2wttD (D:)
  gsdedtyylqvrgrenfeilmklkeslelmelvpqplvdsyrqqqqllqrp
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2wttD (D:)
  dtyylqvrgrenfeilmklkeslelmelvpqplvdsyrqqqqllqrp
  

  
  
• Chain 'E':
  Sequence, based on SEQRES records: (download)
  

  >2wttE (E:)
  gsdedtyylqvrgrenfeilmklkeslelmelvpqplvdsyrqqqqllqrp
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2wttE (E:)
  edtyylqvrgrenfeilmklkeslelmelvpqplvdsyrqqq
  

  
  
• Chain 'F':
  Sequence, based on SEQRES records: (download)
  

  >2wttF (F:)
  gsdedtyylqvrgrenfeilmklkeslelmelvpqplvdsyrqqqqllqrp
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2wttF (F:)
  tyylqvrgrenfeilmklkeslelmelvpqplvdsyrqqqql
  

  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'I':
  No sequence available.
  
  
• Chain 'J':
  No sequence available.
  
  
• Chain 'K':
  No sequence available.
  
  
• Chain 'L':
  No sequence available.
  
  
• Chain 'M':
  No sequence available.
  
  
• Chain 'N':
  Sequence, based on SEQRES records: (download)
  

  >2wttN (N:)
  gsdedtyylqvrgrenfeilmklkeslelmelvpqplvdsyrqqqqllqrp
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2wttN (N:)
  tyylqvrgrenfeilmklkeslelmelvpqplvdsyrqqqql
  

  
  
• Chain 'O':
  No sequence available.
  
  
• Chain 'P':
  No sequence available.