![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.53: p53 tetramerization domain [47718] (1 superfamily) core: 4 helices; bundle |
![]() | Superfamily a.53.1: p53 tetramerization domain [47719] (2 families) ![]() homotetramer |
![]() | Family a.53.1.0: automated matches [259188] (1 protein) not a true family |
![]() | Protein automated matches [259190] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [311354] (9 PDB entries) |
![]() | Domain d2wttd_: 2wtt D: [344664] automated match to d5hobg_ |
PDB Entry: 2wtt (more details), 2.3 Å
SCOPe Domain Sequences for d2wttd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wttd_ a.53.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} dtyylqvrgrenfeilmklkeslelmelvpqplvdsyrqqqqllqrp
Timeline for d2wttd_: