SCOPe 2.08: Domain d6omoi_: 6omo I:

Lineage for d6omoi_ (6omo I:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins)

6. Protein automated matches [190307] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187121] (9 PDB entries)

8. Domain d6omoi_: 6omo I: [368694]
   automated match to d2r52a_
   complexed with ipa, nag, peg

Details for d6omoi_

PDB Entry: 6omo, 2.8 Å

PDB Description: human bmp6 homodimer

PDB Compounds: (I:) Bone morphogenetic protein 6

SCOPe Domain Sequences for d6omoi_:

Sequence; same for both SEQRES and ATOM records:

>d6omoi_ g.17.1.2 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tacrkhelyvsfqdlgwqdwiiapkgyaanycdgecsfplnahmnatnhaivqtlvhlmn
peyvpkpccaptklnaisvlyfddnsnvilkkyrnmvvracgch

Timeline for d6omoi_:

• d6omoi_ first appeared in SCOPe 2.07