Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
Protein automated matches [190161] (29 species) not a true protein |
Species Bacillus licheniformis [TaxId:1402] [188244] (18 PDB entries) |
Domain d5zftb_: 5zft B: [366714] automated match to d2blma_ complexed with ced; mutant |
PDB Entry: 5zft (more details), 1.93 Å
SCOPe Domain Sequences for d5zftb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zftb_ e.3.1.1 (B:) automated matches {Bacillus licheniformis [TaxId: 1402]} ddfakleeqfdaklgifaldtgtnrtvayrpderfafastikaltvgvllqqksiedlnq ritytrddlvnynpitekhvdtgmtlkeladaslrysdnaaqnlilkqiggpeslkkelr kigdevtnperfypelnevnpgetqdtstaralvtslrafaledklpsekrellidwmkr nttgdaliragvpdgwevadktgaasygtrndiaiiwppkgdpvvlavlssrdkkdakyd dkliaeatkvvmkalnm
Timeline for d5zftb_: