Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
Protein automated matches [190406] (19 species) not a true protein |
Species Stichodactyla haddoni [TaxId:475174] [366510] (2 PDB entries) |
Domain d6jc6d1: 6jc6 D:4-225 [366575] Other proteins in same PDB: d6jc6a2, d6jc6b2, d6jc6c2, d6jc6d2 automated match to d1yzwa_ |
PDB Entry: 6jc6 (more details), 1.9 Å
SCOPe Domain Sequences for d6jc6d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jc6d1 d.22.1.1 (D:4-225) automated matches {Stichodactyla haddoni [TaxId: 475174]} llkesmrikmdmegtvnghyfkcegegdgnpftgtqsmrihvtegaplpfafdilapccx srtfihhtagipdffkqsfpegftwertttyedggiltahqdtslegncliykvkvlgtn fpadgpvmknksegwepctevvypdngvlcgrnvmalkvgdrrlichlyssykskkaira ltmpgfhftdirlqmprkkkdeyfelyeasvarysdlpek
Timeline for d6jc6d1: