Lineage for d6iczc5 (6icz C:829-949)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2560339Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) (S)
  5. 2560433Family d.58.11.0: automated matches [254210] (1 protein)
    not a true family
  6. 2560434Protein automated matches [254469] (4 species)
    not a true protein
  7. 2560458Species Homo sapiens [TaxId:9606] [365902] (3 PDB entries)
  8. 2560464Domain d6iczc5: 6icz C:829-949 [365951]
    Other proteins in same PDB: d6icza_, d6iczb_, d6iczc1, d6iczc2, d6iczc4, d6iczd_, d6icze_, d6iczf_, d6iczg_, d6iczh_, d6iczi_, d6iczj_, d6iczk_, d6iczl_, d6iczm_, d6iczn_, d6iczo_, d6iczp_, d6iczq1, d6iczq2, d6iczr1, d6iczr2, d6iczs_, d6iczt_, d6iczu1, d6iczu2, d6iczv_, d6iczy_
    automated match to d3jb9b4

Details for d6iczc5

PDB Entry: 6icz (more details), 3 Å

PDB Description: cryo-em structure of a human post-catalytic spliceosome (p complex) at 3.0 angstrom
PDB Compounds: (C:) 116 kDa U5 small nuclear ribonucleoprotein component

SCOPe Domain Sequences for d6iczc5:

Sequence; same for both SEQRES and ATOM records: (download)

>d6iczc5 d.58.11.0 (C:829-949) automated matches {Homo sapiens [TaxId: 9606]}
epyyfvevqapadcvsavytvlarrrghvtqdapipgsplytikafipaidsfgfetdlr
thtqgqafslsvfhhwqivpgdpldksivirplepqpaphlarefmiktrrrkglsedvs
i

SCOPe Domain Coordinates for d6iczc5:

Click to download the PDB-style file with coordinates for d6iczc5.
(The format of our PDB-style files is described here.)

Timeline for d6iczc5: