Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) |
Family d.58.11.0: automated matches [254210] (1 protein) not a true family |
Protein automated matches [254469] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [365902] (3 PDB entries) |
Domain d6iczc5: 6icz C:829-949 [365951] Other proteins in same PDB: d6icza_, d6iczb_, d6iczc1, d6iczc2, d6iczc4, d6iczd_, d6icze_, d6iczf_, d6iczg_, d6iczh_, d6iczi_, d6iczj_, d6iczk_, d6iczl_, d6iczm_, d6iczn_, d6iczo_, d6iczp_, d6iczq1, d6iczq2, d6iczr1, d6iczr2, d6iczs_, d6iczt_, d6iczu1, d6iczu2, d6iczv_, d6iczy_ automated match to d3jb9b4 complexed with atp, gtp, ihp, mg, zn |
PDB Entry: 6icz (more details), 3 Å
SCOPe Domain Sequences for d6iczc5:
Sequence; same for both SEQRES and ATOM records: (download)
>d6iczc5 d.58.11.0 (C:829-949) automated matches {Human (Homo sapiens) [TaxId: 9606]} epyyfvevqapadcvsavytvlarrrghvtqdapipgsplytikafipaidsfgfetdlr thtqgqafslsvfhhwqivpgdpldksivirplepqpaphlarefmiktrrrkglsedvs i
Timeline for d6iczc5:
View in 3D Domains from same chain: (mouse over for more information) d6iczc1, d6iczc2, d6iczc3, d6iczc4 |