SCOPe 2.07: Domain d6iczy_: 6icz y:

Lineage for d6iczy_ (6icz y:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.0: automated matches [191529] (1 protein)
   not a true family

6. Protein automated matches [190896] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188315] (105 PDB entries)

8. Domain d6iczy_: 6icz y: [365958]
   Other proteins in same PDB: d6icza_, d6iczb_, d6iczc1, d6iczc2, d6iczc3, d6iczc4, d6iczc5, d6iczd_, d6icze_, d6iczf_, d6iczg_, d6iczh_, d6iczi_, d6iczj_, d6iczk_, d6iczl_, d6iczm_, d6iczn_, d6iczo_, d6iczq1, d6iczq2, d6iczr1, d6iczr2, d6iczs_, d6iczt_, d6iczu1, d6iczu2, d6iczv_
   automated match to d3mdfa_
   complexed with atp, gtp, i6p, mg, zn

Details for d6iczy_

PDB Entry: 6icz, 3 Å

PDB Description: cryo-em structure of a human post-catalytic spliceosome (p complex) at 3.0 angstrom

PDB Compounds: (y:) peptidyl-prolyl cis-trans isomerase e

SCOPe Domain Sequences for d6iczy_:

Sequence; same for both SEQRES and ATOM records:

>d6iczy_ d.58.7.0 (y:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krvlyvgglaeevddkvlhaafipfgditdiqipldyetekhrgfafvefelaedaaaai
dnmneselfgrtirvnlak

Timeline for d6iczy_:

• d6iczy_ is new in SCOPe 2.07-stable
  
• d6iczy_ appears in the current release, SCOPe 2.08