Lineage for d1juga_ (1jug A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2924180Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2924181Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2924219Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. 2924284Protein Lysozyme [53961] (15 species)
    ubiquitous in a variety of tissues and secretions
  7. 2924285Species Australian echidna (Tachyglossus aculeatus) [TaxId:9261] [53972] (1 PDB entry)
  8. 2924286Domain d1juga_: 1jug A: [36587]
    complexed with ca

Details for d1juga_

PDB Entry: 1jug (more details), 1.9 Å

PDB Description: lysozyme from echidna milk (tachyglossus aculeatus)
PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d1juga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1juga_ d.2.1.2 (A:) Lysozyme {Australian echidna (Tachyglossus aculeatus) [TaxId: 9261]}
kilkkqelcknlvaqgmngyqhitlpnwvctafhessyntratnhntdgstdygilqins
rywchdgktpgsknacniscskllddditddlkcakkiageakgltpwvawkskcrghdl
skfkc

SCOPe Domain Coordinates for d1juga_:

Click to download the PDB-style file with coordinates for d1juga_.
(The format of our PDB-style files is described here.)

Timeline for d1juga_: