Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.2: C-type lysozyme [53960] (3 proteins) automatically mapped to Pfam PF00062 |
Protein Lysozyme [53961] (15 species) ubiquitous in a variety of tissues and secretions |
Species Australian echidna (Tachyglossus aculeatus) [TaxId:9261] [53972] (1 PDB entry) |
Domain d1juga_: 1jug A: [36587] complexed with ca |
PDB Entry: 1jug (more details), 1.9 Å
SCOPe Domain Sequences for d1juga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1juga_ d.2.1.2 (A:) Lysozyme {Australian echidna (Tachyglossus aculeatus) [TaxId: 9261]} kilkkqelcknlvaqgmngyqhitlpnwvctafhessyntratnhntdgstdygilqins rywchdgktpgsknacniscskllddditddlkcakkiageakgltpwvawkskcrghdl skfkc
Timeline for d1juga_: