Lineage for d1jug__ (1jug -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 28759Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 28760Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 28769Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 28802Protein Lysozyme [53961] (13 species)
  7. 28803Species Australian echidna (Tachyglossus aculeatus) [TaxId:9261] [53972] (1 PDB entry)
  8. 28804Domain d1jug__: 1jug - [36587]

Details for d1jug__

PDB Entry: 1jug (more details), 1.9 Å

PDB Description: lysozyme from echidna milk (tachyglossus aculeatus)
PDB Compounds: ( :)

SCOP Domain Sequences for d1jug__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jug__ d.2.1.2 (-) Lysozyme {Australian echidna (Tachyglossus aculeatus)}
kilkkqelcknlvaqgmngyqhitlpnwvctafhessyntratnhntdgstdygilqins
rywchdgktpgsknacniscskllddditddlkcakkiageakgltpwvawkskcrghdl
skfkc

SCOP Domain Coordinates for d1jug__:

Click to download the PDB-style file with coordinates for d1jug__.
(The format of our PDB-style files is described here.)

Timeline for d1jug__: