SCOPe 2.08: Domain d6fu3a1: 6fu3 A:1-170

Lineage for d6fu3a1 (6fu3 A:1-170)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.0: automated matches [191374] (1 protein)
   not a true family

6. Protein automated matches [190453] (26 species)
   not a true protein

7. Species Neisseria gonorrhoeae [TaxId:485] [365812] (2 PDB entries)

8. Domain d6fu3a1: 6fu3 A:1-170 [365813]
   Other proteins in same PDB: d6fu3b3
   automated match to d1zzha1
   complexed with ca, hec

Details for d6fu3a1

PDB Entry: 6fu3, 1.8 Å

PDB Description: structure of the mixed-valence, active form, of cytochrome c peroxidase from obligate human pathogenic bacterium neisseria gonorrhoeae

PDB Compounds: (A:) Protein CcpR

SCOPe Domain Sequences for d6fu3a1:

Sequence; same for both SEQRES and ATOM records:

>d6fu3a1 a.3.1.0 (A:1-170) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
mgedqdllkraqgvfqplptveemqkirpfteeqvklghqlwyeprlskgntvscnschn
lasagvdnmptsqghkgqfggrnsptalnaallgsqfwdgraadveeqaggplvnpvema
ndsqeaaaakiakvpeyqemfkkafpedgavsfknittalgafertlltp

Timeline for d6fu3a1:

• d6fu3a1 first appeared in SCOPe 2.07