Class b: All beta proteins [48724] (180 folds) |
Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily) sandwich, 10 strands in 2 sheets; greek-key |
Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) |
Family b.21.1.0: automated matches [191353] (1 protein) not a true family |
Protein automated matches [190378] (9 species) not a true protein |
Species Human adenovirus 26 [TaxId:46928] [364422] (5 PDB entries) |
Domain d6fjoa_: 6fjo A: [364423] automated match to d1knba_ complexed with glu, gol, so4 |
PDB Entry: 6fjo (more details), 1.17 Å
SCOPe Domain Sequences for d6fjoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fjoa_ b.21.1.0 (A:) automated matches {Human adenovirus 26 [TaxId: 46928]} rrtlwttpdtspnckmstekdskltltltkcgsqvlgnvsllavtgeyhqmtattkkdvk isllfdengillpssslskdywnyrsddsivsqkynnavpfmpnltaypkpsaqnaknys rtkiisnvylgaltyqpviitiafnqetengcaysitftftwqkdysaqqfdvtsftfsy ltq
Timeline for d6fjoa_: