Lineage for d6qi7a_ (6qi7 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804248Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2804271Protein beta-Lactoglobulin [50827] (4 species)
  7. 2804272Species Cow (Bos taurus) [TaxId:9913] [50828] (76 PDB entries)
    Uniprot P02754
  8. 2804343Domain d6qi7a_: 6qi7 A: [364289]
    automated match to d5k06a_
    complexed with edo, plm

Details for d6qi7a_

PDB Entry: 6qi7 (more details), 2.5 Å

PDB Description: engineered beta-lactoglobulin: variant l39y in complex with endogenous ligand
PDB Compounds: (A:) beta-lactoglobulin

SCOPe Domain Sequences for d6qi7a_:

Sequence, based on SEQRES records: (download)

>d6qi7a_ b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]}
vtqtmkgldiqkvagtwyslamaasdislldaqsapyrvyveelkptpegdleillqkwe
ngecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacqcl
vrtpevddealekfdkalkalpmhirlsfnptqleeqchi

Sequence, based on observed residues (ATOM records): (download)

>d6qi7a_ b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]}
vtqtmkgldiqkvagtwyslamaasdislldaqsapyrvyveelkptgdleillqkweng
ecaqkkiiaektkipavfkidenkvlvldtdykkyllfcmenslacqclvrtpevddeal
ekfdkalkalpmhirlsfnptqleeqchi

SCOPe Domain Coordinates for d6qi7a_:

Click to download the PDB-style file with coordinates for d6qi7a_.
(The format of our PDB-style files is described here.)

Timeline for d6qi7a_: