Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries) |
Domain d6hweh_: 6hwe H: [364087] Other proteins in same PDB: d6hweb_, d6hwec_, d6hwed_, d6hwee_, d6hwef_, d6hweg_, d6hwei_, d6hwej_, d6hwek_, d6hwel_, d6hwen_, d6hweo_, d6hwep_, d6hweq_, d6hwer_, d6hwes_, d6hwet_, d6hweu_, d6hwew_, d6hwex_, d6hwey_, d6hwez_ automated match to d5fg9h_ complexed with cl, gwz, mes, mg, so4; mutant |
PDB Entry: 6hwe (more details), 2.3 Å
SCOPe Domain Sequences for d6hweh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hweh_ d.153.1.4 (H:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcaaagtaadteavtqlig snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee
Timeline for d6hweh_: