Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries) |
Domain d5fg9h_: 5fg9 H: [314117] Other proteins in same PDB: d5fg9a_, d5fg9e_, d5fg9g_, d5fg9i_, d5fg9j_, d5fg9k_, d5fg9l_, d5fg9n_, d5fg9o_, d5fg9s_, d5fg9u_, d5fg9w_, d5fg9x_, d5fg9y_, d5fg9z_ automated match to d4r17h_ complexed with mg; mutant |
PDB Entry: 5fg9 (more details), 2.6 Å
SCOPe Domain Sequences for d5fg9h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fg9h_ d.153.1.4 (H:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} tsvgttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavt qligsnielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihah gstdvgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvc vmeigkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee
Timeline for d5fg9h_: