Lineage for d6hweh_ (6hwe H:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2993738Domain d6hweh_: 6hwe H: [364087]
    Other proteins in same PDB: d6hweb_, d6hwec1, d6hwec2, d6hwed_, d6hwee_, d6hwef_, d6hweg_, d6hwei_, d6hwej_, d6hwek_, d6hwel_, d6hwen_, d6hweo_, d6hwep_, d6hweq1, d6hweq2, d6hwer_, d6hwes_, d6hwet_, d6hweu_, d6hwew_, d6hwex_, d6hwey_, d6hwez_
    automated match to d5fg9h_
    complexed with cl, gwz, mes, mg, so4; mutant

Details for d6hweh_

PDB Entry: 6hwe (more details), 2.3 Å

PDB Description: yeast 20s proteasome beta2-g45a mutant in complex with carfilzomib
PDB Compounds: (H:) Proteasome subunit beta type-2

SCOPe Domain Sequences for d6hweh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hweh_ d.153.1.4 (H:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcaaagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee

SCOPe Domain Coordinates for d6hweh_:

Click to download the PDB-style file with coordinates for d6hweh_.
(The format of our PDB-style files is described here.)

Timeline for d6hweh_: