SCOPe 2.07: Domain d6c73b_: 6c73 B:

Lineage for d6c73b_ (6c73 B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families)

5. Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)

6. Protein automated matches [190054] (15 species)
   not a true protein

7. Species Salmonella enterica [TaxId:90371] [362653] (1 PDB entry)

8. Domain d6c73b_: 6c73 B: [362654]
   Other proteins in same PDB: d6c73a_
   automated match to d4hpjb_
   complexed with cl, cs, dms, edo, f9f, peg, plp; mutant

Details for d6c73b_

PDB Entry: 6c73, 1.65 Å

PDB Description: tryptophan synthase q114a mutant (internal aldimine state) in complex with n-(4'-trifluoromethoxybenzenesulfonyl)-2-amino-1-ethylphosphate (f9f) with cesium ion bound in the metal coordination site

PDB Compounds: (B:) tryptophan synthase beta chain

SCOPe Domain Sequences for d6c73b_:

Sequence; same for both SEQRES and ATOM records:

>d6c73b_ c.79.1.1 (B:) automated matches {Salmonella enterica [TaxId: 90371]}
ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk
cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagahgvasal
asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsy
etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf
adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis
agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm
mreqpekeqllvvnlsgrgdkdiftvhdilkarge

Timeline for d6c73b_:

• d6c73b_ is new in SCOPe 2.07-stable
  
• d6c73b_ appears in the current release, SCOPe 2.08