Lineage for d6c73b_ (6c73 B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2480698Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2480699Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2480700Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 2480954Protein automated matches [190054] (15 species)
    not a true protein
  7. 3062591Species Salmonella enterica [TaxId:90371] [362653] (1 PDB entry)
  8. 3062592Domain d6c73b_: 6c73 B: [362654]
    Other proteins in same PDB: d6c73a_
    automated match to d4hpjb_
    complexed with cl, cs, dms, edo, f9f, peg, plp; mutant

Details for d6c73b_

PDB Entry: 6c73 (more details), 1.65 Å

PDB Description: tryptophan synthase q114a mutant (internal aldimine state) in complex with n-(4'-trifluoromethoxybenzenesulfonyl)-2-amino-1-ethylphosphate (f9f) with cesium ion bound in the metal coordination site
PDB Compounds: (B:) tryptophan synthase beta chain

SCOPe Domain Sequences for d6c73b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c73b_ c.79.1.1 (B:) automated matches {Salmonella enterica [TaxId: 90371]}
ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk
cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagahgvasal
asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsy
etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf
adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis
agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm
mreqpekeqllvvnlsgrgdkdiftvhdilkarge

SCOPe Domain Coordinates for d6c73b_:

Click to download the PDB-style file with coordinates for d6c73b_.
(The format of our PDB-style files is described here.)

Timeline for d6c73b_:

  • d6c73b_ appears in periodic updates to SCOPe 2.07 starting on 2019-01-24