Lineage for d4hpjb_ (4hpj B:)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
consists of two similar domains related by pseudo dyad; duplication
core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) 
Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins) 
Protein Tryptophan synthase, beta-subunit [53688] (4 species) 
Species Salmonella enterica [TaxId:90371] [229810] (6 PDB entries) 
Domain d4hpjb_: 4hpj B: [230040]
Other proteins in same PDB: d4hpja_
automated match to d4hpxb_
complexed with 1d0, bcn, cl, cs, f9f, peg
Details for d4hpjb_
PDB Entry: 4hpj (more details), 1.45 Å
PDB Description: crystal structure of tryptophan synthase at 1.45 a resolution in complex with 2-aminophenol quinonoid in the beta site and the f9 inhibitor in the alpha site
PDB Compounds: (B:) tryptophan synthase beta chainSCOPe Domain Sequences for d4hpjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hpjb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella enterica [TaxId: 90371]}
ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk
cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasal
asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsy
etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf
adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis
agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm
mreqpekeqllvvnlsgrgdkdiftvhdilkarge
SCOPe Domain Coordinates for d4hpjb_:
Click to download the PDB-style file with coordinates for d4hpjb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4hpjb_:
- d4hpjb_ first appeared in SCOPe 2.03
- d4hpjb_ appears in SCOPe 2.06
- d4hpjb_ appears in the current release, SCOPe 2.08
View in 3D
