SCOPe 2.03: Domain d4hpjb_: 4hpj B:

Lineage for d4hpjb_ (4hpj B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families)

5. Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)

6. Protein Tryptophan synthase, beta-subunit [53688] (3 species)

7. Species Salmonella enterica [TaxId:90371] [229810] (5 PDB entries)

8. Domain d4hpjb_: 4hpj B: [230040]
   Other proteins in same PDB: d4hpja_
   automated match to d4hpxb_
   complexed with 1d0, bcn, cl, cs, f9f, peg

Details for d4hpjb_

PDB Entry: 4hpj, 1.45 Å

PDB Description: crystal structure of tryptophan synthase at 1.45 a resolution in complex with 2-aminophenol quinonoid in the beta site and the f9 inhibitor in the alpha site

PDB Compounds: (B:) tryptophan synthase beta chain

SCOPe Domain Sequences for d4hpjb_:

Sequence; same for both SEQRES and ATOM records:

>d4hpjb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella enterica [TaxId: 90371]}
ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk
cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasal
asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsy
etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf
adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis
agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm
mreqpekeqllvvnlsgrgdkdiftvhdilkarge

Timeline for d4hpjb_:

• d4hpjb_ is new in SCOPe 2.03-stable
  
• d4hpjb_ appears in SCOPe 2.04
  
• d4hpjb_ appears in the current release, SCOPe 2.08