Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (17 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries) |
Domain d6mj4c2: 6mj4 C:116-204 [362256] Other proteins in same PDB: d6mj4a1, d6mj4a2, d6mj4b_, d6mj4c1, d6mj4d1, d6mj4d2 automated match to d2pyfa2 protein/RNA complex; complexed with fuc, gol, jtg, na, nag |
PDB Entry: 6mj4 (more details), 2 Å
SCOPe Domain Sequences for d6mj4c2:
Sequence, based on SEQRES records: (download)
>d6mj4c2 b.1.1.2 (C:116-204) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksdfacanafnnsiipedtffps
>d6mj4c2 b.1.1.2 (C:116-204) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnfacanafnnsiipedtffps
Timeline for d6mj4c2: