Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries) |
Domain d6mj4d1: 6mj4 D:2-112 [362303] Other proteins in same PDB: d6mj4a1, d6mj4b_, d6mj4c2 automated match to d3q5ya1 protein/RNA complex; complexed with fuc, gol, jtg, na, nag |
PDB Entry: 6mj4 (more details), 2 Å
SCOPe Domain Sequences for d6mj4d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6mj4d1 b.1.1.0 (D:2-112) automated matches {Human (Homo sapiens) [TaxId: 9606]} aavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdip dgykasrpsqenfslilelatpsqtsvyfcasgdegytqyfgpgtrllvle
Timeline for d6mj4d1: