Lineage for d6mj4c2 (6mj4 C:116-204)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (15 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (888 PDB entries)
  8. 3062194Domain d6mj4c2: 6mj4 C:116-204 [362256]
    Other proteins in same PDB: d6mj4a1, d6mj4a2, d6mj4b_, d6mj4c1, d6mj4d1, d6mj4d2
    automated match to d2pyfa2
    protein/RNA complex; complexed with fuc, gol, jtg, na, nag

Details for d6mj4c2

PDB Entry: 6mj4 (more details), 2 Å

PDB Description: crystal structure of mcd1d/inktcr ternary complex bound to glycolipid (xxw)
PDB Compounds: (C:) T cell receptor alpha variable 11,T cell receptor alpha variable 11,T cell receptor alpha joining 18,Human nkt tcr alpha chain, CHIMERIC PROTEIN

SCOPe Domain Sequences for d6mj4c2:

Sequence, based on SEQRES records: (download)

>d6mj4c2 b.1.1.2 (C:116-204) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records): (download)

>d6mj4c2 b.1.1.2 (C:116-204) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnfacanafnnsiipedtffps

SCOPe Domain Coordinates for d6mj4c2:

Click to download the PDB-style file with coordinates for d6mj4c2.
(The format of our PDB-style files is described here.)

Timeline for d6mj4c2:

  • d6mj4c2 appears in periodic updates to SCOPe 2.07 starting on 2019-01-17