SCOPe 2.07: Domain d6mivc1: 6miv C:2-115

Lineage for d6mivc1 (6miv C:2-115)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d6mivc1: 6miv C:2-115 [362242]
   Other proteins in same PDB: d6miva1, d6mivb_, d6mivc2
   automated match to d2pyfa1
   complexed with fuc, gol, ju1, na, nag

Details for d6mivc1

PDB Entry: 6miv, 2.05 Å

PDB Description: crystal structure of the mcd1d/xxq (jj300)/inktcr ternary complex

PDB Compounds: (C:) T cell receptor alpha variable 11,T cell receptor alpha variable 11,T cell receptor alpha joining 18,Human nkt tcr alpha chain, CHIMERIC PROTEIN,Human nkt tcr alpha chain

SCOPe Domain Sequences for d6mivc1:

Sequence; same for both SEQRES and ATOM records:

>d6mivc1 b.1.1.0 (C:2-115) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tqveqspqslvvrqgencvlqcnysvtpdnhlrwfkqdtgkglvsltvlvdqkdktsngr
ysatldkdakhstlhitatllddtatyicvvgdrgsalgrlhfgagtqlivipd

Timeline for d6mivc1:

• d6mivc1 is new in SCOPe 2.07-stable
  
• d6mivc1 appears in the current release, SCOPe 2.08