Lineage for d6mivc1 (6miv C:2-115)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (25 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1180 PDB entries)
  8. 3062180Domain d6mivc1: 6miv C:2-115 [362242]
    Other proteins in same PDB: d6miva1, d6mivb_, d6mivc2
    automated match to d2pyfa1
    complexed with fuc, gol, ju1, na, nag

Details for d6mivc1

PDB Entry: 6miv (more details), 2.05 Å

PDB Description: crystal structure of the mcd1d/xxq (jj300)/inktcr ternary complex
PDB Compounds: (C:) T cell receptor alpha variable 11,T cell receptor alpha variable 11,T cell receptor alpha joining 18,Human nkt tcr alpha chain, CHIMERIC PROTEIN,Human nkt tcr alpha chain

SCOPe Domain Sequences for d6mivc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mivc1 b.1.1.0 (C:2-115) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tqveqspqslvvrqgencvlqcnysvtpdnhlrwfkqdtgkglvsltvlvdqkdktsngr
ysatldkdakhstlhitatllddtatyicvvgdrgsalgrlhfgagtqlivipd

SCOPe Domain Coordinates for d6mivc1:

Click to download the PDB-style file with coordinates for d6mivc1.
(The format of our PDB-style files is described here.)

Timeline for d6mivc1:

  • d6mivc1 appears in periodic updates to SCOPe 2.07 starting on 2019-01-17