SCOPe 2.07: Domain d6mivc2: 6miv C:116-204

Lineage for d6mivc2 (6miv C:116-204)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d6mivc2: 6miv C:116-204 [362243]
   Other proteins in same PDB: d6miva1, d6miva2, d6mivb_, d6mivc1, d6mivd1, d6mivd2
   automated match to d2pyfa2
   complexed with fuc, gol, ju1, na, nag

Details for d6mivc2

PDB Entry: 6miv, 2.05 Å

PDB Description: crystal structure of the mcd1d/xxq (jj300)/inktcr ternary complex

PDB Compounds: (C:) T cell receptor alpha variable 11,T cell receptor alpha variable 11,T cell receptor alpha joining 18,Human nkt tcr alpha chain, CHIMERIC PROTEIN,Human nkt tcr alpha chain

SCOPe Domain Sequences for d6mivc2:

Sequence, based on SEQRES records:

>d6mivc2 b.1.1.2 (C:116-204) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records):

>d6mivc2 b.1.1.2 (C:116-204) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnkfacanafnnsiipedtffps

Timeline for d6mivc2:

• d6mivc2 is new in SCOPe 2.07-stable
  
• d6mivc2 appears in the current release, SCOPe 2.08