SCOPe 2.07: Domain d6cuga1: 6cug A:3-183

Lineage for d6cuga1 (6cug A:3-183)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein automated matches [191280] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189896] (33 PDB entries)

8. Domain d6cuga1: 6cug A:3-183 [362107]
   Other proteins in same PDB: d6cuga2, d6cugb_, d6cugd1, d6cugd2, d6cuge1, d6cuge2
   automated match to d3l9ra1
   complexed with cl, cuy, nag, pov

Details for d6cuga1

PDB Entry: 6cug, 2.4 Å

PDB Description: crystal structure of bc8b tcr-cd1b-pc complex

PDB Compounds: (A:) T-cell surface glycoprotein cd1b

SCOPe Domain Sequences for d6cuga1:

Sequence; same for both SEQRES and ATOM records:

>d6cuga1 d.19.1.1 (A:3-183) automated matches {Human (Homo sapiens) [TaxId: 9606]}
afqgptsfhviqtssftnstwaqtqgsgwlddlqihgwdsdsgtaiflkpwskgnfsdke
vaeleeifrvyifgfarevqdfagdfqmkypfeiqgiagcelhsggaivsflrgalggld
flsvknascvpspeggsraqkfcaliiqyqgimetvrillyetcpryllgvlnagkadlq
r

Timeline for d6cuga1:

• d6cuga1 is new in SCOPe 2.07-stable
  
• d6cuga1 appears in the current release, SCOPe 2.08