Lineage for d6cuga1 (6cug A:3-183)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2506503Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2506504Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2506505Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2507461Protein automated matches [191280] (4 species)
    not a true protein
  7. 2507471Species Human (Homo sapiens) [TaxId:9606] [189896] (27 PDB entries)
  8. 3062045Domain d6cuga1: 6cug A:3-183 [362107]
    Other proteins in same PDB: d6cuga2, d6cugb_, d6cugd1, d6cugd2, d6cuge1, d6cuge2
    automated match to d3l9ra1
    complexed with cl, cuy, nag, pov

Details for d6cuga1

PDB Entry: 6cug (more details), 2.4 Å

PDB Description: crystal structure of bc8b tcr-cd1b-pc complex
PDB Compounds: (A:) T-cell surface glycoprotein cd1b

SCOPe Domain Sequences for d6cuga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cuga1 d.19.1.1 (A:3-183) automated matches {Human (Homo sapiens) [TaxId: 9606]}
afqgptsfhviqtssftnstwaqtqgsgwlddlqihgwdsdsgtaiflkpwskgnfsdke
vaeleeifrvyifgfarevqdfagdfqmkypfeiqgiagcelhsggaivsflrgalggld
flsvknascvpspeggsraqkfcaliiqyqgimetvrillyetcpryllgvlnagkadlq
r

SCOPe Domain Coordinates for d6cuga1:

Click to download the PDB-style file with coordinates for d6cuga1.
(The format of our PDB-style files is described here.)

Timeline for d6cuga1:

  • d6cuga1 appears in periodic updates to SCOPe 2.07 starting on 2019-01-17