Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily) duplication: consists of 3 similar intertwined domains structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta |
Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) |
Family d.130.1.0: automated matches [254267] (1 protein) not a true family |
Protein automated matches [254617] (15 species) not a true protein |
Species Cryptosporidium parvum [TaxId:353152] [362018] (1 PDB entry) |
Domain d6c07d2: 6c07 D:134-259 [362062] automated match to d4odja2 complexed with cl, k, mg |
PDB Entry: 6c07 (more details), 1.85 Å
SCOPe Domain Sequences for d6c07d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6c07d2 d.130.1.0 (D:134-259) automated matches {Cryptosporidium parvum [TaxId: 353152]} digagdqgmmfgyatnetkelmplthvlatsitreldyirvkgvssrvgwlrpdgkaqvt veynckhgvlipkrihtilvsvqhdenieneeirefvlenvikkvcpsdlmdketrilin psgrft
Timeline for d6c07d2: